DPCstruct | MC22433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 111 |
|---|---|
| Mean domain length (aa) | 187 ± 39 aa |
| Standard deviation of domain lengths | 38.74 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.49 |
| Pfam Score | 88.36 |
| Assigned Pfam label(s) | CL0260- PF17657 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S6DJ26 | 1-172 | DKVFRAGTIGTVAEKTAFGYVKGYMNDSGTHKRGAEIDRLVKSCTGVKRTTGQHPGGIIVVPDYMDIYDFTPIQYPADDQSSAWKTT… |
| A0A3N5RAU5 | 307-472 | DFSWKERDEIVQYVFQKYGYSRVAFISTHVTIKARSAFRETAKVFGFSDEEISKLSRYIPWTDARNLPEVSKKFPESRSLNFDDEPW… |
| A0A059X2U4 | 42-223 | None |
| C2KW35 | 125-390 | None |
| A0A3D0W0J9 | 254-408 | None |
| A0A087CNX9 | 23-218 | None |
| A0A7Y2DHU4 | 69-263 | None |
| A0A3S0DD83 | 89-258 | None |
| A0A829GJ96 | 647-903 | None |
| A0A2I8CYM0 | 16-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.