DPCstruct | MC22432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 80 ± 5 aa |
| Standard deviation of domain lengths | 5.11 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 65.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0ST68 | 1-84 | MPRDNIVQHAELRRMTVLEYAPESVQANHYRNLATKIHGNAGKGIIPTPITMDELEDMLMEHGIMKAVDESQIGKTAAELAATA |
| A0A2P9GWV3 | 71-137 | MIHFVPRDNMVQRAEINRKTVIEFDPEHSQANEYRALASKIEKNGMQVIPKPMNQDQLEKLLIEHGL |
| X5PTE9 | 121-200 | None |
| Q7X1F8 | 178-261 | None |
| A0A1Z4V0P2 | 52-129 | None |
| A0A317MR56 | 1-85 | None |
| A0A5C0DSJ6 | 159-238 | None |
| A0A7X6E691 | 145-220 | None |
| A0A7Z9CRH2 | 86-169 | None |
| A0A7X0A261 | 140-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.