DPCstruct | MC22430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 100 ± 8 aa |
| Standard deviation of domain lengths | 8.07 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 25.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V0I2B5 | 5-103 | NSHFLMALGRVDGGHAIEVADEQLREVISAVNRTGKKGTVTVTLEVNPNGETGFAVTARVKATAPQLQFGQSFFFMGRDGDLTREAP… |
| A0A5D9BZ73 | 20-123 | CNTLGEFIQTLEDGQFSADCYQAVKQLNADLCDTAFHNGGKAKGKLTIVVDIAQEGGVVSLKSTYKVVSPEPPRAKSILWQTPDNRF… |
| A0A516WEB7 | 2-82 | None |
| A0A560L3Q8 | 16-110 | None |
| A0A1Q4WFF8 | 19-120 | None |
| A0A223G867 | 6-107 | None |
| A0A0S9MX79 | 4-115 | None |
| A0A1H4M4Y6 | 4-96 | None |
| A0A2D3WV10 | 14-105 | None |
| A0A410SC94 | 6-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.