DPCstruct | MC2243
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 128 ± 16 aa |
| Standard deviation of domain lengths | 15.87 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.17 |
| Pfam Score | 68.20 |
| Assigned Pfam label(s) | CL0229- CL0177- PF12451 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453BV02 | 9-118 | QEETELMKREIEDLKTNAKVFQLSKCTACTFTLDLPAVHFMCMHSFHLRCLGDNEKECPECAPEYRSVMEAKQKLELNARDHDLFFR… |
| A0A093Z5I4 | 8-146 | LQKTIERERRDIDSNQRVISSYRAETEAKRREIEELSTKPVVFQATRCARCGSPLDPPMVHFLCKHSFHQLCLNVPNEAEGEKWECP… |
| D8UKG1 | 49-150 | None |
| A0A5J4W2T6 | 629-745 | None |
| A0A151TFG9 | 606-744 | None |
| A0A6J1WTR6 | 8-133 | None |
| A0A397F5D7 | 318-449 | None |
| A0A0C2JHD5 | 28-158 | None |
| J4UDN5 | 880-1022 | None |
| A0A2W1BS46 | 527-661 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.