DPCstruct | MC22427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 149 ± 19 aa |
| Standard deviation of domain lengths | 18.72 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2KTC0 | 5-124 | IRQSDKDSQEYTPSSTSDVSGSSQDAVINLAQDDRDAEEETSTDVPSHARPRKAINWIWDYVHRLDEMVMHKGAEYTHIYLLCLQNN… |
| A0A6A3YE33 | 9-169 | TDLPPSRTPEIPSASPSTVASSTLSPTAPRPASSVGVDAFGVPLAIRHHRQDRGRHDVWELAHQLDEPYVSSENNEAATFTHVCLLC… |
| W2Z584 | 55-177 | None |
| D0NGG7 | 112-275 | None |
| A0A0W8CDU8 | 29-187 | None |
| W2XZK5 | 58-218 | None |
| A0A329RAM0 | 28-186 | None |
| V9E757 | 16-162 | None |
| H3H8J3 | 189-324 | None |
| W2PPY5 | 56-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.