DPCstruct | MC22421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Standard deviation of domain lengths | 5.71 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 49.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0093 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3ANE5 | 231-310 | EPPDPMLLKNAFESKDLYFYCGHGDGGRYLSGEELQRLPRCPATVLMGCSSGVLKQQGRLPPCGMALNYLHARCPALVAN |
| A0A835IDS7 | 1-86 | MAQGKAETPSVEELVLALKSHDLFLYFGHGNGTQFLPKYEIEKISSCAATLLMGCSSGSLPFVGCYNPHGIVLSYLLAGSPAIIAN |
| A0A395IMX8 | 287-361 | None |
| A0A7J7MIA0 | 295-365 | None |
| M4B6W9 | 138-217 | None |
| W2YV04 | 70-149 | None |
| P18296 | 1684-1754 | None |
| A5C0X5 | 459-540 | None |
| A0A6V7P8I8 | 229-297 | None |
| A0A0D2LSY6 | 433-510 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.