DPCstruct | MC22420
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 4.99 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 81.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151R6I0 | 56-132 | THAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFVLGFFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN |
| A0A835IDP2 | 35-110 | DAPLGSFNSVGGVAIEINAVNYVSPRSWLATSHFVLGFFLFGGSFVAWGRARAAAAGFEKGIDRDLEPVLFMTPLN |
| A0A7S0CKW5 | 305-382 | None |
| K0RJ67 | 337-414 | None |
| A0A823A6C2 | 466-541 | None |
| A0A2N9H999 | 595-670 | None |
| A0A7J9I2W7 | 1-60 | None |
| A0A7J9I1L9 | 4-78 | None |
| A0A7J6ENX8 | 56-125 | None |
| A0A396I1Y2 | 204-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.