DPCstruct | MC2242
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 220 ± 35 aa |
| Standard deviation of domain lengths | 34.56 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9HKY7 | 183-409 | MLYDQAQLAVAYSAAYLATKDEFYADIVRDILLYVSRDLSDKSGGFYSAEDADSYPSHDAKSKKEGAFCVWNYDELQRLLDKPIEGS… |
| A0A093YY15 | 1-229 | MLYDNAQLLHVYLDAFLGLAKPDPELLGVVLDLAAYLTSAPIAREGGGFYSSQDADSFYRRGDKETREGAYYVWTARELETLLPAQA… |
| A0A5N4D5N7 | 927-1110 | None |
| A0A060S9J0 | 246-502 | None |
| L8GM78 | 471-680 | None |
| A0A7C5GCN0 | 166-353 | None |
| A0A7I8CYF4 | 132-285 | None |
| A0A5J4YMN7 | 314-603 | None |
| A0A395J824 | 209-469 | None |
| A0A017TIA1 | 614-801 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.