DPCstruct | MC22418
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 100 ± 8 aa |
| Standard deviation of domain lengths | 7.96 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 55.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803MVP3 | 341-444 | LWKKYGKYIDYVNFQFYSYEQITSKSEFITYFKNETENYKDGMILASYISDGSTGLKPGKDFLTACEKLKEMNLLHGIFFWCADDSK… |
| A0A835I9W2 | 1-106 | MALWSKYGHLIDYVNFQFYAYDQGTSVSQFMKYFETQSSHYQGGKIMASFATDGSGGLSPNDGFFTACSRLKSQGNLHGIFIWSADD… |
| A0A6A6LG92 | 186-267 | None |
| A0A200QHQ3 | 1064-1167 | None |
| A0A835LJW6 | 372-465 | None |
| A0A4Y1RKK0 | 137-233 | None |
| A0A199VVA9 | 751-853 | None |
| A0A061GWM0 | 86-187 | None |
| A0A803MVP6 | 183-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.