DPCstruct | MC22415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 64 ± 3 aa |
| Standard deviation of domain lengths | 2.78 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 68.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00551 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811MKZ0 | 592-656 | HNDFLNVSRCFNAQTSTVRVPDLDPKYNISILASKQDHCLFDLLHRWQEGRLPVHINCVISNHDR |
| A0A2U1P1P6 | 153-211 | DEDVLNLSKMFNARKSAVRVPSIDPKYKIAVLVSKQDHCLVDLLLAWQDGKLPIDINAI |
| A0A3L6QBW2 | 230-294 | None |
| A0A6D2KA58 | 1-67 | None |
| G7JXD2 | 126-190 | None |
| A0A5N6NYK2 | 98-156 | None |
| A0A453JA41 | 2-64 | None |
| K7KN52 | 93-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.