DPCstruct | MC22414
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 68 ± 3 aa |
| Standard deviation of domain lengths | 3.22 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 44.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287KPV9 | 35-104 | SYDPCLDNYAAEYLNRRDVQDAMHANTTGNIPYAWTACSDPLFQHWKDSPASTLPVIKRMVDAGLRVWVY |
| A0A835I6F8 | 36-103 | FDPCTDNYANAYLNLPEVQKAFHANLTKWYSCSGLGWHDSPTTILPTIKQLMASNISVCIYRQVQNFV |
| A0A804HMW1 | 3-72 | None |
| A0A061F7F5 | 74-144 | None |
| A0A2H5P3G5 | 4-66 | None |
| A0A4V6A2M3 | 109-175 | None |
| A0A0A9DY21 | 3-73 | None |
| A0A068V731 | 2-70 | None |
| A0A1R3KNT7 | 233-301 | None |
| A0A4S4DRE0 | 248-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.