DPCstruct | MC22412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 122 ± 10 aa |
| Standard deviation of domain lengths | 10.19 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 53.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835GZT8 | 1-102 | MLSVLRVHLPSDIPIVGCELTPYVLLQCPDTSITTDDVPESSPIDGFCLRYRWYHIQSDRKVAICSVHPFEQATLQCLGCVKAKIHV… |
| A0A835I282 | 1-123 | MLSVLRVHLPSDIPIVGCELTSYVLLQCPDTSITTDDVPESSPIYGFCLRYRWYRIQSDRKVAICSVHPFEQATLQCFGCVKAKIHV… |
| A0A2J8A8A4 | 2-114 | None |
| A0A2R6R531 | 1-128 | None |
| A0A3S3M9Y9 | 1-123 | None |
| A0A811MRT7 | 1-124 | None |
| A0A452Y901 | 1-101 | None |
| A0A2P6PEL1 | 59-188 | None |
| A0A0D2K8W7 | 1-127 | None |
| A0A7S0UU93 | 3-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.