DPCstruct | MC22410
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 331 ± 26 aa |
| Standard deviation of domain lengths | 26.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835I064 | 1-367 | MVRKVVEIARTFPEDAYSFLIENENYVEASKLQRIRGNTILKAYMLERVEVYEKSSQLVSFHIVVQIISTDERSGWSMQHAHNLKKL… |
| A0A287J7Z9 | 120-448 | DELFSLEMEKGNFLEAAGMAKYKGDVLLEVDMLEKADLFEDATRLLLLNITVDSFWSSNSRGWPPKGYTEKERLLARAKQMAEKVSE… |
| A0A2I0T667 | 5-332 | None |
| A0A1D6E0S0 | 7-362 | None |
| A0A7J6W032 | 323-671 | None |
| A0A438JRV3 | 1-306 | None |
| A0A4Y7IUV5 | 588-929 | None |
| A0A803NC40 | 1-312 | None |
| A0A2P5CGD1 | 28-345 | None |
| A0A7J6GAP0 | 43-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.