DPCstruct | MC2241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 5.05 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 66.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 55.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0044 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7IQH6 | 1-71 | MTQYIEFVADRLLKALGVDPVYNVTNPFDWMDLISVQGKTNFFEKRVGEYQKAGIMAKKVEQKFTTNDLEF |
| A0A2X1XQ46 | 1-68 | MNAELMCQYIEHTADVIAGLFGFDPIFYAKNPFDYMRLLDMEGKTNFFEKRVTEYKRPQDRQLSFDAD |
| A0A0D2PGG5 | 1-80 | None |
| A0A024G4H5 | 318-376 | None |
| A0A2J8A628 | 273-353 | None |
| A0A6G3MFS0 | 224-298 | None |
| A0A7J9FUS1 | 140-218 | None |
| A0A7R9CIW2 | 266-340 | None |
| P36603 | 312-391 | None |
| A0A2K6SUK7 | 238-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.