DPCstruct | MC22406
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 111 ± 13 aa |
| Standard deviation of domain lengths | 13.21 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 46.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835HTE1 | 92-207 | FDRQQLLKNRIDDHLSLPVGCPQDFEFQNYTIITSQCKGPQYPPTLCCDAFKRFACPYAAYINDLASECAYVMFSYINLYGKYPPGL… |
| A0A5J5NKZ8 | 4-92 | ASTSISACPIEFEFLNYTIITSECKGPKYPANRCCAAFKKFACPYAKQINDLTTDCASTMFSYINLYGKYPPGLFAAECREGKRGLK… |
| A0A7N0RE90 | 60-176 | None |
| A0A2I0HK41 | 6-111 | None |
| A0A4S4D6U9 | 842-965 | None |
| A0A835J258 | 319-443 | None |
| A0A2K1IYE1 | 7-133 | None |
| M4CF58 | 1-77 | None |
| A0A0E0JIC4 | 43-148 | None |
| A0A830CNV5 | 25-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.