DPCstruct | MC224
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 108 ± 17 aa |
| Standard deviation of domain lengths | 17.32 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K3WJ08 | 1-84 | MRLARRPCVKIQYRDDALRAHFCKNAQQLLDFVQTDPNNKTMSALIARKALQYRHVRIDRIGDIDVRDPTFDVSHFFDIEWSKV |
| T0Q1X5 | 10-93 | QESHGCAARRHYQLSYSDDAVKQRYDHIVRTTLRLANSPDVNSKNVLLAQKAIKYRRHESDAINYDDPSTDVFESLGITWCKTP |
| A0A3F2RQB4 | 1-109 | None |
| K3WJH1 | 1-115 | None |
| W3A9X0 | 114-210 | None |
| A0A5D6XEP2 | 53-186 | None |
| A0A662XEM6 | 41-157 | None |
| A0A5D6Y8J5 | 117-262 | None |
| A0A2D4CGQ1 | 119-207 | None |
| A0A0W8D389 | 49-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.