DPCstruct | MC22399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 259 |
|---|---|
| Mean domain length (aa) | 225 ± 52 aa |
| Standard deviation of domain lengths | 52.17 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 83.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 17.68 |
| Pfam Score | 83.88 |
| Assigned Pfam label(s) | PF21082- PF21088- CL0010- PF01544- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8FBG1 | 52-208 | PSRTGDWVLLADGTYGNVTAQTPEIVTLRLKGGALKYYPTSDYMAQSPTNLSHGYRLTCIFGVDYQHQGIVIREIQEMMKKAVSEGL… |
| A0A2V7EWQ7 | 24-264 | VLGTLVAAAGERRALGVGVTGLARAAVRVFVLVIGGLILLDAIGVRITPLLTALGVGGLAVALALQDTLSNLFAGVHLLADRPIRVG… |
| A0A0N0P9C9 | 10-161 | None |
| A0A4Y7KRK2 | 71-289 | None |
| A0A4Y7JDF5 | 65-279 | None |
| A0A7V9ZZG1 | 1-185 | None |
| A0A7V6GNP8 | 606-778 | None |
| A0A1B0C786 | 183-414 | None |
| A0A1S8VLH2 | 950-1196 | None |
| A0A7J3WB96 | 13-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.