DPCstruct | MC22398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1150 |
|---|---|
| Mean domain length (aa) | 126 ± 25 aa |
| Standard deviation of domain lengths | 24.69 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 16.11 |
| Pfam Score | 92.77 |
| Assigned Pfam label(s) | CL0084- PF07335- CL0029- CL0229- CL0209 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N1HVN8 | 4-163 | SDLLAKVTSCSQISNGKYKTDDETSATVPVCGKNGAVFWKADMDIDCDGQRTTNCNEDRDPWYQDDTAFHQSDGKPLKAESLPYVVV… |
| A0A2V7EC41 | 11-127 | CATPGVVRTPAPSLLGTEWTGLASWYGDPHHGRETASGEVFDKTKPTAAHRALPFGTRLAVTNLDNGRTVEVRVNDRGPFVNGRIID… |
| A0A4Q6FZD0 | 12-151 | None |
| A0A261DCZ3 | 61-165 | None |
| A0A7S1UP23 | 159-309 | None |
| A0A5P1F3W9 | 10-124 | None |
| A0A4S4DPH8 | 41-183 | None |
| A0A4S4DHT8 | 199-274 | None |
| A0A387HSC3 | 138-263 | None |
| A0A519T6I8 | 33-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.