DPCstruct | MC22394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 258 ± 20 aa |
| Standard deviation of domain lengths | 20.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 18.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0368 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V6E060 | 10-266 | NAMRTLIVLLIISMAAFAWAPRTHIEIARLAEPLLENDIFPDLLDLFREERGAIYSGTNFPDWANGGYTPQWASRAHSMAFVDKYLE… |
| A0A3M1K6Y1 | 20-308 | HAHGINGHVWVSEQGLAGLRECNTELRELLDEADARNAYRFGAAFPDSGYATSRGREYGEAAHWERFLQFMIDDWRARFSRRLDDPE… |
| A0A3M1CXY2 | 1-282 | None |
| A0A2E5X6C2 | 1-272 | None |
| A0A1Q7E8E1 | 1-214 | None |
| A0A1W9THS5 | 8-257 | None |
| A0A1X2G5A0 | 2-262 | None |
| A0A1H0QQS3 | 1-268 | None |
| A0A522BK86 | 10-269 | None |
| A0A1V5P068 | 1-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.