DPCstruct | MC22393
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 159 ± 14 aa |
| Standard deviation of domain lengths | 14.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5N4Q1 | 4-179 | YNSPDHVVDEEIFTNRIDATLPAIKRISVEAMAKKYETEEDAWHGIANTINDFYIEEYPEIYEERRDAINEAILVVQDKYQQNIFPE… |
| A0A7X9F8F1 | 260-410 | PFIKKAAMEVLRNNFSDKDSAMNQIRESISAFYKSEFPEFYDSHKDLINQAISALQSEFSKNTFPAMKVTYDVYPNHIGHLESEGCF… |
| A0A7C5B5X7 | 322-466 | None |
| A0A2D6PZV9 | 1-140 | None |
| A0A7C7QQ67 | 228-370 | None |
| A0A522ULW9 | 7-133 | None |
| A0A3N5FBZ4 | 1-151 | None |
| A0A3M1MW27 | 19-171 | None |
| A0A3N5L3Y0 | 319-493 | None |
| A0A521WIV0 | 27-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.