DPCstruct | MC22390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 127 |
|---|---|
| Mean domain length (aa) | 196 ± 45 aa |
| Standard deviation of domain lengths | 45.13 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.17 |
| Pfam Score | 80.48 |
| Assigned Pfam label(s) | PF03799- CL0191 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A358GWD4 | 6-154 | VDRVVVSRAWPNGIRVRVMPRHAIARWGTGRLLSDGGDVFSEAEPTIHPELPLLHGPVSQSKMMMRRYNEINQLFHPANLRLKELYL… |
| A0A7C5F8D2 | 27-232 | LQIRQIGVKGNIKITTEEIQGRLGSFMGENLLLIDENEVQAKMSSDKRINQIEIKRKWPSTLLIQLTEKKPVLLLDYSQMWGLSPEG… |
| A0A2D8N254 | 27-286 | None |
| R6QZ48 | 2-187 | None |
| A0A3S0PDT6 | 28-270 | None |
| A0A7V1I4I6 | 1-100 | None |
| R5Z4W7 | 19-214 | None |
| A0A1G1DIV5 | 48-285 | None |
| A0A2G9X302 | 18-204 | None |
| A0A520T0C4 | 33-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.