DPCstruct | MC2239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 126 |
|---|---|
| Mean domain length (aa) | 254 ± 44 aa |
| Standard deviation of domain lengths | 44.30 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 13.01 |
| Pfam Score | 46.65 |
| Assigned Pfam label(s) | CL0724- PF06113- PF13096- CL0229- CL0208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J7RHT7 | 5-283 | LIDDELQEVSKLCQHVITGSKLVSCVQTMVRVEIRRTTFKHIVACIQFPSDYPFSPLLIELKSKTLSDKLLDGLTNVCEQEAKKIIG… |
| A0A7K4CQ03 | 76-334 | YNAVQGLKDELRMIEGEFVMQLLKDNYIRVTLISFNKLEYNVELDLERYPDVKWIFAPETIKQIGNAEDFMARYTKAKKAPTLLDIL… |
| A0A0W0CU75 | 425-731 | None |
| I1CPU7 | 9-247 | None |
| A0A803Q0W9 | 111-424 | None |
| A0A2W1BVI1 | 354-546 | None |
| C5DXB6 | 1-293 | None |
| A0A6A4JWZ2 | 361-669 | None |
| A0A0M8MZ14 | 186-472 | None |
| A0A6A4JQG4 | 889-1164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.