DPCstruct | MC22388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 162 ± 17 aa |
| Standard deviation of domain lengths | 16.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 33.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A143QG08 | 2-146 | IGGIIARLPEYGWPSALFARRDVLILTLATTGLPYTQIAALRACDVTADACLDALRVEAGRGVRTVTSLALAGTGISPRTVYQRWCE… |
| A0A562DL37 | 24-163 | AVELPTTGWPSGLFGRRDALLLVLAATGMTFTDITRLRRRDLQLDGNALVVTTRAGERFRLEPEPAAGDNPAAAIYRRWAEIQTFLD… |
| C8XJB1 | 39-230 | None |
| A0A1X7LWJ3 | 86-247 | None |
| A0A426QUW4 | 75-242 | None |
| A0A7X6L197 | 99-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.