DPCstruct | MC22385
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 217 ± 31 aa |
| Standard deviation of domain lengths | 30.79 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9UVC3 | 2-152 | DENYLQVYEDAVGKYTGFFDDVNNVLGSMHKHLSTSESGKIFIESEFRDAVGETLRKWERDNVLIDGLNPSEATAWAESIGPLAYAD… |
| A0A6M5HVN2 | 14-224 | DGFVEAEALLRALQSLIPSPRPDSSWEIYAALAEAISVMNEEYLGKYQTVVMKYTEFFDDVNSAMGGMSEFIQVSDDGEVYVSPQFR… |
| A0A2A2GVP2 | 2-219 | None |
| A0A6G9RJM4 | 163-365 | None |
| A0A193QEJ8 | 137-373 | None |
| A0A0R0DEB9 | 20-245 | None |
| A0A3L7LS61 | 20-207 | None |
| A0A839VF90 | 148-384 | None |
| A0A7D5SN01 | 31-235 | None |
| A0A7T1H098 | 85-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.