DPCstruct | MC22384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 173 ± 35 aa |
| Standard deviation of domain lengths | 34.70 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.53 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | CL0082- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y7I0L5 | 145-338 | VQAASSYYIPYEGANAKVKEDFPLGFLPSYGSSIAFKGTNANGELEFYGLTDRGPNGDGPNLPALSGSGTTGAKIFPSPSFTPAFGV… |
| A0A6L9YC84 | 2-167 | ETNNPEVVDTSNEVTLIGFASLPADTFADGPESGKDVDSTRTGPFPGQPVGGWSGVQFADNDSYWFIVDSLFGSNSDTLARIYKVDP… |
| A4CRX2 | 18-145 | None |
| A0A3Q9EYJ3 | 1-146 | None |
| A0A1X6PHB1 | 1-275 | None |
| H8GTD2 | 1-157 | None |
| A0A1E5QR51 | 504-665 | None |
| A0A5B1BG51 | 1-158 | None |
| A0A2S7KXU1 | 1-142 | None |
| A0A542QT39 | 15-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.