DPCstruct | MC22383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 159 |
|---|---|
| Mean domain length (aa) | 119 ± 25 aa |
| Standard deviation of domain lengths | 25.09 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF19553- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A327S3K1 | 4-135 | ECLYCGKTIKVKPSHYERKKYCSRKCQFSYQKDNPPDFWFASSFKKIVNCSNCNKELLRKPSSISKKNFCCRSCKIDFQRKNSKELS… |
| A0A8B2NV26 | 12-131 | FCERCGTPIETHLSYRRFCSGRCKRMVYYREAHPVEPRTCAGCGVTFLPRRSDAKYCSPKCGNAVRNPFNVAVYREERLKQIAGRTC… |
| A0A3A4Z8I6 | 1-133 | None |
| A0A7J0BII7 | 14-112 | None |
| A0A1V5GRC5 | 63-151 | None |
| A0A542Z873 | 5-142 | None |
| A0A354UAM4 | 1-103 | None |
| A0A1I0BMS0 | 1-94 | None |
| A0A6B0GPE6 | 95-235 | None |
| A0A1I5R520 | 1-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.