DPCstruct | MC22381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 94 ± 13 aa |
| Standard deviation of domain lengths | 13.06 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y4ZIQ4 | 6-102 | RAEIAAMVAEGLAGADDVVQRAWARLAMPPAEWECEGAPDGERFWVVGRIAAEIVWYNHIEEGFNRSPCRSERVIGEYRCNQSTFAE… |
| A0A8B2NJ48 | 3-93 | RAIDALSLPERQFWEAIKVEPQKWRCPPWGDAGGGFWVVGLFGQYVIWYNDIEDGFNCSRYTTRGTIGEYTCDQNELQYTVRSLKVL… |
| H1Z9Y7 | 16-101 | None |
| A0A699GFB8 | 923-1013 | None |
| A0A7X3FWR5 | 2-98 | None |
| A0A7S9L0U1 | 15-108 | None |
| A0A177LKK8 | 3-73 | None |
| A0A7X7DR65 | 12-121 | None |
| A0A654CMV1 | 3-63 | None |
| A0A3D9KBP0 | 183-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.