DPCstruct | MC22378
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 84 ± 9 aa |
| Standard deviation of domain lengths | 9.44 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 96.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 53.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3C4T5 | 71-158 | IYETQSTHKLLAAFSQASMIHVKGDVNEETFNEAYMMHTTTSPHYGIVASTETAAAMMKGNAGKRLIDGSIERSIKFRKEIKRLKGES |
| A0A4U9WQ52 | 2-85 | IYETQSTHKLLAAFSQASMIHVKGDINEETFNEAYMMHTTTSPHYGIVASTETAAAMMKGNAGKRMINGSIERAIKFRKEIKRL |
| A0A2X3CCV0 | 55-143 | None |
| A0A7K4BFA5 | 184-265 | None |
| A0A485BEQ5 | 1-73 | None |
| A0A6F9EIC1 | 65-146 | None |
| A0A4U9U313 | 19-107 | None |
| A0A4U9HKE6 | 38-120 | None |
| A0A7I8CHL0 | 3-114 | None |
| A0A376RDA2 | 92-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.