DPCstruct | MC22374
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Standard deviation of domain lengths | 7.79 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X8WRM8 | 30-94 | NNIQGILKTTKSRFNCAILGFGFFKIRLSNGLIGYTRQCELRLNKEFELVNKQYSFYNKIFMPRE |
| A0A4U9WK54 | 1-78 | MQIGTGVRPVATERIHSQGNLSQTNNSKDVAIKGQGFFQVVLPDGTQAYTRDGSFQIDQNGQLVTASGFQVQPAITIP |
| A0A060QLU3 | 5-91 | None |
| A0A2B4R383 | 70-142 | None |
| A0A377F9M8 | 27-113 | None |
| A0A6I1KIR1 | 80-152 | None |
| A0A379WWB7 | 111-180 | None |
| A0A7X2PKL4 | 72-135 | None |
| A0A2V3INH5 | 1-76 | None |
| A0A2X4TYL1 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.