DPCstruct | MC22371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 74 ± 2 aa |
| Standard deviation of domain lengths | 1.80 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 93.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 51.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0525 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M4GK79 | 89-161 | MTDSALSTFKAKDHYNRTRPFVYNKQASCTPEEEASLAKNGSYPSGHAALGWAWGLVLAELMPNRADALFQRA |
| A0A4U9WFW7 | 1-76 | MREDTGDLATRSAKEHYMRTRPFAFYHQATCRPEEESVLSTNGSYPSGHTSIGWATALVLAEINPVRQGEILKRGL |
| A0A7G7KEF3 | 137-209 | None |
| A0A248KBS6 | 46-119 | None |
| A0A378C757 | 120-194 | None |
| A0A8B1Z7U8 | 303-376 | None |
| A0A812RXM6 | 60-132 | None |
| A0A3S4GDE7 | 1-74 | None |
| A0A2R7PFY7 | 129-197 | None |
| A0A1T4V1D4 | 102-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.