DPCstruct | MC22370
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 94 ± 6 aa |
| Standard deviation of domain lengths | 6.11 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 43.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00696 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B8QDT3 | 29-119 | DENDPAIANPTKFIGPVYAEEEAKQLAEQNNWIVKPDGAYWRRVVPSPTPKEVLEIKAIQDLLEKEHLIICGGGGGAPVVEKDGAYY… |
| A0A4U9WET9 | 1-98 | MDKQDPGFTNPTKPIGAFFSEQQRDALLQQYPTWRFVEDSGRGYRRVVASPEPIRIVEADAIKALTQQGFVVIGAGGGGIPVARNSQ… |
| R6Z1Q8 | 20-113 | None |
| A0A255PAF6 | 89-182 | None |
| W7C657 | 218-310 | None |
| A0A841DL44 | 274-365 | None |
| A0A2V7IFY8 | 944-1047 | None |
| W9T803 | 111-202 | None |
| A0A813D975 | 8-104 | None |
| A0A5C8JDR8 | 114-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.