DPCstruct | MC2237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 252 ± 16 aa |
| Standard deviation of domain lengths | 15.94 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5TXP2 | 6-231 | RLESFRTPKTYVTVVYWLIGGLVLGLLLVRPGAWWTPALAWVYVVLAWLYFNWRYSPVVQFPVLHTAHNVVGRWAATTDRPESVRKL… |
| A0A5C9EKC1 | 1-281 | MVEMMHKEFTELMGRWCIPRLVGSEGSHKIVKLLKQDFDRFNFECEEQEFPVFKSDTSFKLSRKLAIIGVLSSIFLILFWILFLYSL… |
| A0A416ZFC4 | 4-265 | None |
| A0A2N3F8N1 | 6-239 | None |
| A0A0F9Q9E5 | 8-263 | None |
| A0A532TKI4 | 1-263 | None |
| N2C0A4 | 10-262 | None |
| A0A538EXN0 | 2-234 | None |
| A0A437UTR6 | 6-242 | None |
| A0A1F8QE10 | 17-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.