DPCstruct | MC22369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 91 ± 9 aa |
| Standard deviation of domain lengths | 8.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R5JE47 | 89-164 | YGEIKPEYTYGASRFDFFLPGKPPCLIEVKSVTLVERGRARFPDAPTERGRKHLLELIAARENEFRCIIIFVVQRR |
| A0A4U9WC93 | 1-96 | MNYPVYSKITGEVKYGGENSRIDLLLQAENRVDCYIEVKSVTLLQHQQGYFPDAVTLRGQKHLRELQNVVEQGQRAVLFFAVFTQRH… |
| A0A3M3JTA7 | 255-350 | None |
| A0A497ERP7 | 1-97 | None |
| A0A6N8FDV4 | 466-568 | None |
| A0A7J2LD97 | 106-197 | None |
| A0A514XHA0 | 105-198 | None |
| A0A7V2NUQ8 | 93-177 | None |
| A0A510E0X2 | 71-155 | None |
| A0A7U9XJQ1 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.