DPCstruct | MC22365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 283 ± 29 aa |
| Standard deviation of domain lengths | 28.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2K781 | 71-341 | VQPKCRVEGESAILALQRGDYLQAFDQLYRGQSNYWYDAAAVAERVLTVDELKQYVDAQVPAPPALSQEDRDNYVPLPVAASLRNLL… |
| R4YHD4 | 6-256 | QAKENYWPDVAHIAERVLTVNELLAFVDKYVPAPSPLAPTTPKNAGRDSADARLRNLLARRLMRAGQYQKALAYFALAEDRDAARAF… |
| A0A7W7YEH0 | 444-746 | None |
| G1Y2T2 | 227-553 | None |
| A0A2V5W796 | 868-1130 | None |
| A0A3S5AF68 | 1-281 | None |
| A0A178MCX1 | 718-947 | None |
| A0A433SAH5 | 433-740 | None |
| D4E097 | 322-607 | None |
| A0A809SDD2 | 32-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.