DPCstruct | MC22364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 228 ± 30 aa |
| Standard deviation of domain lengths | 30.07 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04730 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M2G0I4 | 3-173 | ISGDSHESEHTIGFEPLNQTSGLKRGTAGRAKELENQAPAYQEIKSSHRNHIGTGNSNTLDDSGFNSSSYRETQRNLIESGDISSAV… |
| I4IAB8 | 29-235 | RFSAPSVGRRQSFELGVHGARSREQRRLSRDFGFRVSGNTHESEHSVGFEPINRTSGERRGTVGARFLENQAPAYQEVKDFHRSHIG… |
| A0A7G8BNS9 | 18-201 | None |
| A0A817P7T6 | 1006-1223 | None |
| A0A0F7FTD4 | 1-260 | None |
| A0A3S1BZY9 | 50-253 | None |
| A0A849JQ21 | 61-320 | None |
| A0A0F5YM64 | 25-233 | None |
| A0A2Z6EXJ5 | 42-323 | None |
| A0A6A1TKC8 | 9-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.