DPCstruct | MC22362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 245 ± 53 aa |
| Standard deviation of domain lengths | 53.18 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 74.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A2BMS5 | 14-190 | GRFQVMALLQAARYYQLRGDLEKAKSWGLNRAIFYAWAKHYGPRYRAYSVTLEELLRRSRERRPGSKCPEGMVEVLGECVQVSPRGW… |
| A0A4S9RZT8 | 259-471 | DPKAETGFEDDDEEEDSPIICGVVRDPEPPPHVDIMADNASLLELWAAMVTRRIYHWLSWQTCLQIGNAVMVVCIASGDDFFELDRS… |
| J3PHY9 | 40-307 | None |
| A0A4S9N004 | 12-216 | None |
| R9NY81 | 34-333 | None |
| A0A6M1LK80 | 4-149 | None |
| A0A0M8MR07 | 57-379 | None |
| R4XFD0 | 62-263 | None |
| A0A7S0J9L3 | 52-274 | None |
| A0A1Y2D446 | 4-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.