DPCstruct | MC22361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 151 ± 12 aa |
| Standard deviation of domain lengths | 11.56 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 34.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S9RP61 | 1-148 | MSSSGDNQVAACAAGFSLGFGYLTTVRAIHQTRANRAPWRSAYIWMIWGEILANLCLGILTWLWLKDIVKNGPVLLFFILFFYVFEV… |
| A0A507AJC4 | 5-157 | FLIPPWYEADKPSEASKLMVSFIWGFSTAIAAFIVAKGLRQTYQMCRRLKRVNPYVILIWLELATSFAMSIVCWLFLNGILQPSFWV… |
| A0A179F2G5 | 2-143 | None |
| A0A0G4MN29 | 1-159 | None |
| A0A5N5P0Y2 | 7-143 | None |
| A0A395SYY1 | 1-135 | None |
| A0A3M9XWP2 | 7-158 | None |
| A0A0K6G084 | 215-361 | None |
| A0A0B7KSQ5 | 195-351 | None |
| B2B3Q6 | 1-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.