DPCstruct | MC2236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 116 |
|---|---|
| Mean domain length (aa) | 200 ± 43 aa |
| Standard deviation of domain lengths | 42.57 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04855 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2L8N6 | 8-163 | SSKAPVKFRMPTADNLVPIRLDIEIDGHRFRDAFTWNPSDPDSEVVIFAKRTVKDLKLPPAFVMQIAQSIQTQLTDFRSYEGQDMYT… |
| A0A176W4G6 | 2-217 | RLDVEYEGRRLKDAFTWNVDDPDIEIYPFVRRMAKDLNLPSGFTPIIAQQMQTQLDEFRSLEAQEMTTEERVQTLRLDLRVNNTVVH… |
| A0A178F3E0 | 815-954 | None |
| A0A093XK80 | 244-465 | None |
| A0A5J4YIF4 | 11-268 | None |
| A0A433QHH3 | 173-426 | None |
| Q4N6B6 | 113-273 | None |
| A0A5J4P1V5 | 227-447 | None |
| L0ATR1 | 92-275 | None |
| Q4UD88 | 59-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.