DPCstruct | MC22358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 113 |
|---|---|
| Mean domain length (aa) | 382 ± 91 aa |
| Standard deviation of domain lengths | 91.06 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0649 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C0VEA0 | 2-295 | IVVRSISYGPAVVEERINAVVEELKHLGGVPNYFGHQRFGTKRPVTHLVGRQIVKGNLEEASLTFLSLPSPFEDPDAREARRLIREA… |
| A0A4P5XYJ8 | 261-631 | YEPSGEGEHLYLGIQKENMPHDEMLRIVADHFKVDPDSIGTAGRKDRHAVTRQAISVNIPGKEPPTELTHDRLLVLWTLRHGNKLRT… |
| A0A3E1KAG5 | 167-503 | None |
| A0A7S3ZR11 | 69-414 | None |
| A0A2D6PY66 | 297-685 | None |
| A0A538Q4U6 | 5-343 | None |
| A0A1P8WHG6 | 9-274 | None |
| A0A7S4NX46 | 3-420 | None |
| A0A2E9A3P2 | 163-494 | None |
| A0A2V2VTU6 | 84-479 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.