DPCstruct | MC22352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 115 ± 20 aa |
| Standard deviation of domain lengths | 20.38 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08816 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M3C8X9 | 10-120 | KDVYFSELVKSPGFKESWSKLVSDHTFGPYDKWIPRLSGLRSAVKFVSIDGQDLIKDRSCEPHNCQDNSISILADPKTYDIWMAQRT… |
| A0A1E8PN58 | 9-138 | QARTPKPPFMEQAQRCDGGHTCPYSVELYKADDAFRTASNVALKKAGLKRQRWVADGMASPLKSIEIDGKARLLSRVCEPHNCVHYY… |
| A0A6A8A9X4 | 25-157 | None |
| A0A0N0JVI9 | 1-142 | None |
| A0A4U9HQT9 | 13-108 | None |
| A0A377Z660 | 2-94 | None |
| A0A2W5GIS2 | 19-105 | None |
| A0A4C7ADP0 | 98-218 | None |
| A0A1E3W3U2 | 2-89 | None |
| A0A3D9XMP9 | 41-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.