DPCstruct | MC22350
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 83 ± 5 aa |
| Standard deviation of domain lengths | 5.39 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M7PX76 | 10-86 | ISDHNAMRSLIGRPVRYADEACEICDVLFEESLLVLASLSCDEMQDDSYGRPHRKVPAYHSLPFKDDAGNPSYMWGE |
| A0A1I1P1E8 | 18-101 | DDNEKQARDLLGRTVDYRGRTCRVVELLDDPPALILQDEGSGTEMQANQHGEAHRRVPRNYTVALYHYNAAGEREVHPDFRALQ |
| A0A6N4E268 | 8-86 | None |
| A0A7C1CY55 | 6-90 | None |
| A0A6I7N4M7 | 11-101 | None |
| A0A7C5XSZ5 | 9-94 | None |
| A0A7C3D0R9 | 2-84 | None |
| Q3J7A9 | 25-115 | None |
| A0A363UKA3 | 3-76 | None |
| A0A317MRK9 | 5-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.