DPCstruct | MC22348
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 65 ± 9 aa |
| Standard deviation of domain lengths | 9.05 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 32.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G3L1R8 | 30-85 | GWQVVSPYGYTHPSGWTIERCSINGEWRTLLWKGQHIYDRFENPLAAAVCHADLAQ |
| A0A8A7B9E4 | 17-71 | GWREAGAYGLSHPDGWTIGRYKVSGTDRCLLWGPDGKSQGPYRSVAEAISAFNKL |
| A0A4R4CB49 | 17-90 | None |
| A0A072TD57 | 170-231 | None |
| A0A6P2T4Z5 | 17-77 | None |
| A0A3R7GTW7 | 6-64 | None |
| A0A656QBX1 | 1-69 | None |
| A0A167WQQ5 | 1-66 | None |
| A0A3N8GF58 | 16-74 | None |
| A0A7X1NHS6 | 15-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.