DPCstruct | MC22347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 5.92 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10038 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2MUZ4 | 1-72 | MSRPALKLAKLPDTTPVKITAALPPSLMRDLKIYAKLYEQTYGEKQSVGALIPSMLAGFLVSDHGFKKAKRE |
| A0A8A7B7H6 | 2-73 | STTRKLRLGPLPRTENIKLTFACPVSLKADLDRYAALYAQTYGEAVDATVLIPHMLEAFMARDRGFRKGIGE |
| A0A3S3DQZ9 | 1-61 | None |
| A0A090MFN5 | 1-71 | None |
| H8FWI7 | 1-73 | None |
| A0A853FY74 | 2-70 | None |
| A0A7S9VPL3 | 1-80 | None |
| A0A2N3E3Y7 | 1-72 | None |
| H0TT59 | 1-63 | None |
| A0A2A4SKH8 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.