DPCstruct | MC22346
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 113 ± 12 aa |
| Standard deviation of domain lengths | 12.00 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0567 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0AR67 | 3-86 | NRQRGEVELVIGERTLTLCLTLGALAEIEALCPPGETLGAGRLLLIVEVLARGGGEVIGLDELKAAPIDIGDAAAAVADCFDLG |
| A0A2N3L3W5 | 2-124 | MTANAHRGEIPVTLDGVQRVLRPDFTALSRIETDTGKTLQHLTAHAVACALGVSDMAVILRCGLVAAGEDVSTQTVGQWIIDGGGAV… |
| A0A0R1LEL7 | 24-130 | None |
| A0A5Q0C8P4 | 40-155 | None |
| A0A564VXM1 | 32-148 | None |
| A0A7W6FPX2 | 4-109 | None |
| A0A1Z9Q4F6 | 14-127 | None |
| A0A090MTG3 | 1-108 | None |
| A0A7X3I3B8 | 1-115 | None |
| A0A2P7SQB7 | 42-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.