DPCstruct | MC22344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 127 ± 26 aa |
| Standard deviation of domain lengths | 26.18 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y0BCK0 | 2-106 | GQWAQGACALSADGVYQKFLDPYGSRPFRRIFLARAGPGPVPRPPGVAAFPGPGEGVVSPVLRDVLAANPGVSGFVPGRVTGTIGAA… |
| A0A6P1VBM6 | 19-132 | TTVKPLKASNVQLGNLTKWRDKKIDVLSLYGVEGSVQLAQLPTPASGEYYMSKALAERVAQHPEDKIIDRFGKHTKYLGTIPDAYLQ… |
| A0A101UWA7 | 2-128 | None |
| A0A6B2RJY1 | 51-148 | None |
| A0A2W6B521 | 3-172 | None |
| A0A4D4MZI2 | 50-176 | None |
| A0A656WNV8 | 8-108 | None |
| A0A6N9Y4K2 | 38-159 | None |
| K0JZF7 | 53-156 | None |
| A0A0L0KXP7 | 22-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.