DPCstruct | MC22340
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 182 ± 27 aa |
| Standard deviation of domain lengths | 26.68 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6FAJ8 | 1-156 | MTSIPSEPKTPAEWLKYVHSEVVTSIPSKQEQKTIQNSINERDIYLDESKIIKPPSQLWYAYTDIFAFRKPDITIFPEAYGSIQIIT… |
| A0A554U198 | 1-183 | MHNRIAPGGQPPSDGLAALFDAVETRSGIAGVSSRAIGANEAAFRAMHLDLGEIRAALRAADFAPPLVTICADVLRIPDRFDWTLRG… |
| A0A319E8M8 | 14-171 | None |
| A0A1L9V9Q0 | 1-165 | None |
| A0A4Z1IZ68 | 1-162 | None |
| A0A397TXC5 | 1-167 | None |
| A0A7S8DII8 | 3-184 | None |
| A0A4Z1K619 | 15-176 | None |
| A0A397VZM4 | 32-209 | None |
| A0A2H3FZ65 | 1-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.