DPCstruct | MC2234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 99 ± 9 aa |
| Standard deviation of domain lengths | 8.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 60.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01985 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P1E6R1 | 1-117 | MDSLLDSLGPRYDDWPGPDPLPVDADMLPGIVHGYKPPFRIIPYGVRSSFGYKEGTALRRHAKVLPPHFALGRSRQHQGLAAAMLKL… |
| A0A314XSQ9 | 50-148 | QRELMALNDLNHLLDELGPRFKDWIGREPLPVDADLLPSMVPGYKTPFRLLPYGFRPCLRDKDVTKYRRLARTVPPHFALGRNRELQ… |
| A0A2U1NLU3 | 111-207 | None |
| A0A816N5B5 | 23-112 | None |
| A0A453C5N7 | 203-307 | None |
| A0A7J9EWY3 | 57-141 | None |
| A0A3P5ZU48 | 1-99 | None |
| A0A2P2LPK7 | 24-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.