DPCstruct | MC22332
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 8.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5IAX8 | 17-102 | KDYEHKPKEFNDYDAFFAYNMAVKRLGELEDSLVAKPIDEWTEDDGDCLWWTFPIQEPPHCGSPLDSDFPDYLTHFTRLILPINKD |
| A0A089I813 | 1-94 | MRKEKIMNDLIEELKKTMKREISGPSWVVDELFKPLTEAKSIDEWHEDYGDALWWTFPIQESPYCGSPLDEDWPGYHTHWTPIVIPA… |
| A0A410X0X8 | 13-99 | None |
| A0A5C8UC68 | 200-301 | None |
| A0A089MFW7 | 21-114 | None |
| E0RFT4 | 38-125 | None |
| A0A4U4E2X5 | 3-78 | None |
| A0A5P2QZN2 | 39-141 | None |
| A0A7J0BX54 | 73-153 | None |
| A0A3E0CI60 | 101-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.