DPCstruct | MC2233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 177 ± 17 aa |
| Standard deviation of domain lengths | 17.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A318YBJ0 | 1-164 | MCSLAPAVTIRNYEERNCRNIRGRFAACRNAAERACCDNRPAPTFSSSKFTGLPPTAIGSICTHLRGQNCGLDRDSGHGLSLCLNYP… |
| A0A176VRI4 | 7-186 | FSKMYLIVPMVLLGLSSMVGAVDIIFYGDSGGCRGSGYSFNGAGRQVCCIANGGSVLFTDMDGCKTSLVYRNGGCDRDSVASGTGNR… |
| A0A366PR08 | 1-177 | None |
| B0CWW9 | 7-170 | None |
| A0A2B7Y7C1 | 89-265 | None |
| A0A6A6U9S0 | 1-180 | None |
| J3NLT0 | 4-148 | None |
| A0A066XAD0 | 3-174 | None |
| A0A6S6V211 | 1-193 | None |
| A0A0G4MIG0 | 213-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.