DPCstruct | MC22329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 341 ± 77 aa |
| Standard deviation of domain lengths | 77.07 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 79.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4M7U1 | 1-358 | MDYNLLPPGNLKEKALIEVAIALWTHNPIKDEVLRVFEYRSEHGFDKRWKKIEKIVQEIVKTLELPQTLKAELSGISTQIGLEILRW… |
| A0A4Y2RYG5 | 42-384 | MSASFVPPLKHRILAKTAIIICNDPEVRYFINELNFLWDKNAGKDRFKDLLDKAAKKISELHLPPQLHQSVMALIKPIALEIARWKI… |
| T1JDQ1 | 7-348 | None |
| T1JFB3 | 1-249 | None |
| T1JFX1 | 37-403 | None |
| T1JKV0 | 69-313 | None |
| A0A085LTJ0 | 351-708 | None |
| A0A4Y2MXF3 | 4-344 | None |
| A0A4Y2G5H7 | 16-270 | None |
| A0A444SSA8 | 30-480 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.